PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D00037.2.p
Common NameEUGRSUZ_D00037, LOC104440626
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 268aa    MW: 29981.4 Da    PI: 6.3702
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D00037.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-151663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd++l  ++k++G  +W++ a+  g++R++k+c++rw +yl
  Eucgr.D00037.2.p 16 KGAWSAEEDQKLTAYIKRHGIWNWSRMAEPAGLRRSGKSCRLRWMNYL 63
                      79******************99************************97 PP

2Myb_DNA-binding48.42.2e-1570112246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g++T+eE e ++++++ lG++ W++Ia+++  gRt++++k++w++
  Eucgr.D00037.2.p  70 GNFTKEEVETIIKLHEFLGNK-WSAIASKLD-GRTDNEVKNYWNT 112
                       89*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2451163IPR017930Myb domain
SuperFamilySSF466894.12E-2813110IPR009057Homeodomain-like
SMARTSM007172.4E-111565IPR001005SANT/Myb domain
PfamPF002495.5E-131663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-221770IPR009057Homeodomain-like
CDDcd001675.09E-91863No hitNo description
PROSITE profilePS5129422.17164118IPR017930Myb domain
SMARTSM007172.8E-1468116IPR001005SANT/Myb domain
PfamPF002491.6E-1370112IPR001005SANT/Myb domain
CDDcd001672.19E-1071114No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2471117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MAELGVVLDE KRRLKKGAWS AEEDQKLTAY IKRHGIWNWS RMAEPAGLRR SGKSCRLRWM  60
NYLRPNLRHG NFTKEEVETI IKLHEFLGNK WSAIASKLDG RTDNEVKNYW NTRLKKQFKG  120
KSMQKPRKSE AARVCDSVDA NHESSSQEEA GSSTPTSTPV QLSNLGDFTG IQTSSPENFG  180
SLSSNQAIGV LGDKGNSFDN NLCSSYVDDE VQSYLWAQNF SVEDAHMVQD VGALFMDSTA  240
TVLYPGWPLE MASSASLEDF AVNLWEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141185108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D00037.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010051852.10.0PREDICTED: transcription factor WER-like
TrEMBLA0A059CBQ50.0A0A059CBQ5_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-48MYB-like 102